PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009126823.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 342aa    MW: 37615.1 Da    PI: 5.6708
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009126823.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.94.2e-081958340
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg..Htvv 40
                    +r C+ +++  +  +C+ ++ +lC +C +++H+   H++v
  XP_009126823.1 19 ARSCDACKSASAAVYCRFDSAFLCITCDTSIHSFtrHERV 58
                    578*****************************65789876 PP

2zf-B_box261.9e-0860103542
        zf-B_box   5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                      C+ +e+ ++   C+ +   lC +C + +H+       H++vp+
  XP_009126823.1  60 LCEVCEQAPAAVTCKADAASLCVTCDSDIHSAnplasrHERVPV 103
                     6*****************************66999999999986 PP

3CCT70.15.8e-24274317144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea++lRY+eKrk+RkFeK+irY+sRKa+AesRpR+KGrF+k++
  XP_009126823.1 274 REARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRT 317
                     9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003363.6E-81760IPR000315B-box-type zinc finger
PROSITE profilePS5011910.7931760IPR000315B-box-type zinc finger
CDDcd000216.76E-82058No hitNo description
PfamPF006431.5E-62058IPR000315B-box-type zinc finger
PROSITE profilePS5011910.70856103IPR000315B-box-type zinc finger
CDDcd000213.44E-860103No hitNo description
PfamPF006433.2E-660103IPR000315B-box-type zinc finger
SMARTSM003365.9E-1061103IPR000315B-box-type zinc finger
PfamPF062035.2E-18274316IPR010402CCT domain
PROSITE profilePS5101716.817274316IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGFGLESIKP LSGGWGAAAR SCDACKSASA AVYCRFDSAF LCITCDTSIH SFTRHERVYL  60
CEVCEQAPAA VTCKADAASL CVTCDSDIHS ANPLASRHER VPVESFFDSA VAKISPSTFG  120
VLGDSTTVDL TAVPVIGNAD ELGLCPWLLP HDFNEPAKIE TVTELKSSEF MFSDFDRLID  180
FEYPNTFGAD SLVPVQTKTE PLPVTNNDHC FDIDFCRSKL STFTYPTQSI SHSVSTSSLE  240
YGVVPDGTTS VPFNRSTITT STGTTGEQPS SMDREARVLR YREKRKNRKF EKTIRYASRK  300
AYAESRPRIK GRFAKRTETE NDDVFFSQVY ASAGQYGVVP TF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.32881e-135bud| leaf| root| seed| silique
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894791e-148AC189479.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB081M20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013683363.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5-like
SwissprotQ9FHH80.0COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLM4DV810.0M4DV81_BRARP; Uncharacterized protein
STRINGBra020425.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78992435
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.10.0CONSTANS-like 5